Vitronectin (VTN) (NM_000638) Human Recombinant Protein

Vitronectin protein,

Product Info Summary

SKU: PROTP04004
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Vitronectin (VTN) (NM_000638) Human Recombinant Protein

View all Vitronectin recombinant proteins

SKU/Catalog Number

PROTP04004

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human vitronectin (VTN)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Vitronectin (VTN) (NM_000638) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP04004)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

52.2 kDa

Amino Acid Sequence

MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRAMWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

Validation Images & Assay Conditions

Gene/Protein Information For VTN (Source: Uniprot.org, NCBI)

Gene Name

VTN

Full Name

Vitronectin

Weight

52.2 kDa

Alternative Names

Complement S-protein; epibolin; Serum Spreading Factor; Serum-spreading factor; Somatomedin B; S-protein; V75; vitronectin (serum spreading factor, somatomedin B, complement S-protein); Vitronectin; VN; VNT; VTN VTN V75, VN, VNT vitronectin vitronectin|complement S-protein|epibolin|serum spreading factor|somatomedin B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on VTN, check out the VTN Infographic

VTN infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for VTN: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP04004

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Vitronectin (VTN) (NM_000638) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Vitronectin (VTN) (NM_000638) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Vitronectin (VTN) (NM_000638) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP04004
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product