VILIP3 (HPCAL1) (NM_134421) Human Recombinant Protein

VILIP3 protein,

Product Info Summary

SKU: PROTP37235
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

VILIP3 (HPCAL1) (NM_134421) Human Recombinant Protein

View all VILIP3 recombinant proteins

SKU/Catalog Number

PROTP37235

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human hippocalcin-like 1 (HPCAL1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

VILIP3 (HPCAL1) (NM_134421) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP37235)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.1 kDa

Amino Acid Sequence

MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF

Validation Images & Assay Conditions

Gene/Protein Information For HPCAL1 (Source: Uniprot.org, NCBI)

Gene Name

HPCAL1

Full Name

Hippocalcin-like protein 1

Weight

22.1 kDa

Superfamily

recoverin family

Alternative Names

BDR1Visinin-like protein 3; Calcium-binding protein BDR-1; hippocalcin-like 1; HLP2hippocalcin-like protein 1; VILIP-3 HPCAL1 BDR1, HLP2, VILIP-3 hippocalcin like 1 hippocalcin-like protein 1|calcium-binding protein BDR-1|visinin-like protein 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HPCAL1, check out the HPCAL1 Infographic

HPCAL1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HPCAL1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP37235

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used VILIP3 (HPCAL1) (NM_134421) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For VILIP3 (HPCAL1) (NM_134421) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for VILIP3 (HPCAL1) (NM_134421) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP37235
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.