UROD (NM_000374) Human Recombinant Protein

UROD protein,

Product Info Summary

SKU: PROTP06132
Size: 20 µg
Source: HEK293T

Product Name

UROD (NM_000374) Human Recombinant Protein

View all UROD recombinant proteins

SKU/Catalog Number

PROTP06132

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human uroporphyrinogen decarboxylase (UROD)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UROD (NM_000374) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP06132)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

40.6 kDa

Amino Acid Sequence

MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQVNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQN

Validation Images & Assay Conditions

Gene/Protein Information For UROD (Source: Uniprot.org, NCBI)

Gene Name

UROD

Full Name

Uroporphyrinogen decarboxylase

Weight

40.6 kDa

Superfamily

uroporphyrinogen decarboxylase family

Alternative Names

EC 4.1.1.37; PCT; UPD; URO-D; uroporphyrinogen decarboxylase; uroporphyrinogen III decarboxylase UROD PCT, UPD uroporphyrinogen decarboxylase uroporphyrinogen decarboxylase|uroporphyrinogen III decarboxylase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UROD, check out the UROD Infographic

UROD infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UROD: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP06132

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used UROD (NM_000374) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UROD (NM_000374) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UROD (NM_000374) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP06132
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product