FECH (NM_000140) Human Recombinant Protein

FECH protein,

Recombinant protein of human ferrochelatase (protoporphyria) (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2

Product Info Summary

SKU: PROTP22830
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FECH (NM_000140) Human Recombinant Protein

View all FECH recombinant proteins

SKU/Catalog Number

PROTP22830

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ferrochelatase (protoporphyria) (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FECH (NM_000140) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP22830)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

42.1 kDa

Amino Acid Sequence

MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETAQHAQGAKPQVQPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL

Validation Images & Assay Conditions

Gene/Protein Information For FECH (Source: Uniprot.org, NCBI)

Gene Name

FECH

Full Name

Ferrochelatase, mitochondrial

Weight

42.1 kDa

Superfamily

ferrochelatase family

Alternative Names

EC 4.99.1.1; EPP; FCE; ferrochelatase (protoporphyria); ferrochelatase; ferrochelatase, mitochondrial; Heme synthase; heme synthetase; Protoheme ferro-lyase; protoporphyria FECH EPP, EPP1, FCE ferrochelatase ferrochelatase, mitochondrial|heme synthase|heme synthetase|protoheme ferro-lyase|protoporphyria

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FECH, check out the FECH Infographic

FECH infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FECH: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP22830

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FECH (NM_000140) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FECH (NM_000140) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FECH (NM_000140) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP22830
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product