UGP2 (NM_001001521) Human Recombinant Protein

UGP2 protein,

Product Info Summary

SKU: PROTQ16851
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

UGP2 (NM_001001521) Human Recombinant Protein

View all UGP2 recombinant proteins

SKU/Catalog Number

PROTQ16851

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UGP2 (NM_001001521) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ16851)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

55.5 kDa

Amino Acid Sequence

MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH

Validation Images & Assay Conditions

Gene/Protein Information For UGP2 (Source: Uniprot.org, NCBI)

Gene Name

UGP2

Full Name

UTP--glucose-1-phosphate uridylyltransferase

Weight

55.5 kDa

Superfamily

UDPGP type 1 family

Alternative Names

EC 2.7.7.9; pHC379; UDPG; UDP-glucose diphosphorylase; UDP-glucose pyrophosphorylase 2; UDP-glucose pyrophosphorylase; UDPGP; UDPGP2; UGP1; UGPase 2; UGPase; UGPP2; uridyl diphosphate glucose pyrophosphorylase 2; UTP-glucose-1-phosphate uridyltransferase; UTP--glucose-1-phosphate uridylyltransferase 2; UTP--glucose-1-phosphate uridylyltransferase UGP2 DEE83, EIEE83, SVUGP2, UDPG, UDPGP, UDPGP2, UGP1, UGPP1, UGPP2, pHC379 UDP-glucose pyrophosphorylase 2 UTP--glucose-1-phosphate uridylyltransferase|UDP-glucose diphosphorylase|UDP-glucose pyrophosphorylase 1|UGPase 2|UTP--glucose-1-phosphate uridylyltransferase 2|UTP-glucose-1-phosphate uridyltransferase|Uridyl diphosphate glucose pyrophosphorylase-1|testis tissue sperm-binding protein Li 58p|uridyl diphosphate glucose pyrophosphorylase 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UGP2, check out the UGP2 Infographic

UGP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UGP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ16851

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used UGP2 (NM_001001521) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UGP2 (NM_001001521) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UGP2 (NM_001001521) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ16851
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.