UBE2S (NM_014501) Human Recombinant Protein

UBE2S protein,

Product Info Summary

SKU: PROTQ16763
Size: 20 µg
Source: HEK293T

Product Name

UBE2S (NM_014501) Human Recombinant Protein

View all UBE2S recombinant proteins

SKU/Catalog Number

PROTQ16763

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ubiquitin-conjugating enzyme E2S (UBE2S)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UBE2S (NM_014501) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ16763)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.7 kDa

Amino Acid Sequence

MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For UBE2S (Source: Uniprot.org, NCBI)

Gene Name

UBE2S

Full Name

Ubiquitin-conjugating enzyme E2 S

Weight

23.7 kDa

Superfamily

ubiquitin-conjugating enzyme family

Alternative Names

E2-24K; E2-EPF; E2-EPF5; E2-EPF52; E2-EPFEC 6.3.2.19; E2EPFEPF5; EPF5; UBE2S; Ubiquitin carrier protein S; ubiquitin-conjugating enzyme E2 S; ubiquitin-conjugating enzyme E2-24 kD; Ubiquitin-conjugating enzyme E2-24 kDa; Ubiquitin-conjugating enzyme E2-EPF5; ubiquitin-conjugating enzyme E2S; Ubiquitin-protein ligase S UBE2S E2-EPF, E2EPF, EPF5 ubiquitin conjugating enzyme E2 S ubiquitin-conjugating enzyme E2 S|E2 ubiquitin-conjugating enzyme S|E2-EPF5|ubiquitin carrier protein S|ubiquitin conjugating enzyme E2S|ubiquitin-conjugating enzyme E2-24 kDa|ubiquitin-conjugating enzyme E2-EPF5|ubiquitin-protein ligase S

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UBE2S, check out the UBE2S Infographic

UBE2S infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UBE2S: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ16763

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used UBE2S (NM_014501) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UBE2S (NM_014501) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UBE2S (NM_014501) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ16763
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.