UBE2E1 (NM_182666) Human Recombinant Protein

UbcH6/UBE2E1 protein,

Product Info Summary

SKU: PROTP51965
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

UBE2E1 (NM_182666) Human Recombinant Protein

View all UbcH6/UBE2E1 recombinant proteins

SKU/Catalog Number

PROTP51965

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ubiquitin-conjugating enzyme E2E 1 (UBC4/5 homolog, yeast) (UBE2E1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UBE2E1 (NM_182666) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP51965)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.3 kDa

Amino Acid Sequence

MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT

Validation Images & Assay Conditions

Gene/Protein Information For UBE2E1 (Source: Uniprot.org, NCBI)

Gene Name

UBE2E1

Full Name

Ubiquitin-conjugating enzyme E2 E1

Weight

19.3 kDa

Superfamily

ubiquitin-conjugating enzyme family

Alternative Names

EC 6.3.2.19; UbcH6; UBE2E1; Ubiquitin carrier protein E1; ubiquitin-conjugating enzyme E2 E1; ubiquitin-conjugating enzyme E2E 1 (homologous to yeast UBC4/5); ubiquitin-conjugating enzyme E2E 1 (UBC4/5 homolog, yeast); Ubiquitin-protein ligase E1 UBE2E1 UBCH6 ubiquitin conjugating enzyme E2 E1 ubiquitin-conjugating enzyme E2 E1|(E3-independent) E2 ubiquitin-conjugating enzyme E1|E2 ubiquitin-conjugating enzyme E1|ubiquitin carrier protein E1|ubiquitin conjugating enzyme E2E 1|ubiquitin-conjugating enzyme E2E 1 (UBC4/5 homolog, yeast)|ubiquitin-conjugating enzyme E2E 1 (homologous to yeast UBC4/5)|ubiquitin-protein ligase E1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UBE2E1, check out the UBE2E1 Infographic

UBE2E1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UBE2E1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP51965

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used UBE2E1 (NM_182666) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UBE2E1 (NM_182666) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UBE2E1 (NM_182666) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP51965
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.