UAP56 (DDX39B) (NM_080598) Human Recombinant Protein

UAP56 protein,

Product Info Summary

SKU: PROTQ13838
Size: 20 µg
Source: HEK293T

Product Name

UAP56 (DDX39B) (NM_080598) Human Recombinant Protein

View all UAP56 recombinant proteins

SKU/Catalog Number

PROTQ13838

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human HLA-B associated transcript 1 (BAT1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UAP56 (DDX39B) (NM_080598) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13838)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

48.8 kDa

Amino Acid Sequence

MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR

Validation Images & Assay Conditions

Gene/Protein Information For DDX39B (Source: Uniprot.org, NCBI)

Gene Name

DDX39B

Full Name

Spliceosome RNA helicase DDX39B

Weight

48.8 kDa

Superfamily

DEAD box helicase family

Alternative Names

56 kDa U2AF65-associated protein; ATP-dependent RNA helicase p47; DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B; DEAD box protein UAP56; EC 3.6.4.13; HLA-B associated transcript 1; HLA-B-associated transcript 1 protein; spliceosome RNA helicase BAT1; UAP56D6S81EBAT1nuclear RNA helicase (DEAD family) DDX39B BAT1, D6S81E, UAP56 DExD-box helicase 39B spliceosome RNA helicase DDX39B|56 kDa U2AF65-associated protein|ATP-dependent RNA helicase p47|DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B|DEAD-box helicase 39B|HLA-B-associated transcript 1 protein|nuclear RNA helicase (DEAD family)|spliceosome RNA helicase BAT1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DDX39B, check out the DDX39B Infographic

DDX39B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DDX39B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13838

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used UAP56 (DDX39B) (NM_080598) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UAP56 (DDX39B) (NM_080598) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UAP56 (DDX39B) (NM_080598) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13838
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.