TXNDC (TMX1) (NM_030755) Human Recombinant Protein

TXNDC protein,

Recombinant protein of human thioredoxin-related transmembrane protein 1 (TMX1)

Product Info Summary

SKU: PROTQ9H3N1
Size: 20 µg
Source: HEK293T

Product Name

TXNDC (TMX1) (NM_030755) Human Recombinant Protein

View all TXNDC recombinant proteins

SKU/Catalog Number

PROTQ9H3N1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human thioredoxin-related transmembrane protein 1 (TMX1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TXNDC (TMX1) (NM_030755) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H3N1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

31.6 kDa

Amino Acid Sequence

MAPSGSLAVPLAVMVPLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVNIAKVDVTEQPGLSGRFIINALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSSWFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGSYTVFALATLFSGLLLGLCMIFVADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS

Validation Images & Assay Conditions

Gene/Protein Information For TMX1 (Source: Uniprot.org, NCBI)

Gene Name

TMX1

Full Name

Thioredoxin-related transmembrane protein 1

Weight

31.6 kDa

Alternative Names

DKFZp564E1962; PDIA11; protein disulfide isomerase family A, member 11; thioredoxin domain containing 1; Thioredoxin domain-containing protein 1; thioredoxin domain-containing; thioredoxin-related transmembrane protein 1; TMXTXNDC; Transmembrane Trx-related protein; TXNDC1thioredoxin domain containing

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TMX1, check out the TMX1 Infographic

TMX1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TMX1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H3N1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TXNDC (TMX1) (NM_030755) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TXNDC (TMX1) (NM_030755) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TXNDC (TMX1) (NM_030755) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H3N1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product