Tuberoinfundibular peptide (PTH2) (NM_178449) Human Recombinant Protein

Parathyroid hormone 2 protein,

Product Info Summary

SKU: PROTQ96A98
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Tuberoinfundibular peptide (PTH2) (NM_178449) Human Recombinant Protein

View all Parathyroid hormone 2 recombinant proteins

SKU/Catalog Number

PROTQ96A98

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human parathyroid hormone 2 (PTH2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Tuberoinfundibular peptide (PTH2) (NM_178449) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96A98)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11 kDa

Amino Acid Sequence

METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

Validation Images & Assay Conditions

Gene/Protein Information For PTH2 (Source: Uniprot.org, NCBI)

Gene Name

PTH2

Full Name

Tuberoinfundibular peptide of 39 residues

Weight

11 kDa

Superfamily

parathyroid hormone family

Alternative Names

parathyroid hormone 2TIP39tuberoinfundibular 39 residue protein; TIPF39; tuberoinfundibular 39 residues; tuberoinfundibular peptide of 39 residues PTH2 TIP39 parathyroid hormone 2 tuberoinfundibular peptide of 39 residues|tuberoinfundibular 39 residue protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PTH2, check out the PTH2 Infographic

PTH2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PTH2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96A98

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Tuberoinfundibular peptide (PTH2) (NM_178449) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Tuberoinfundibular peptide (PTH2) (NM_178449) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Tuberoinfundibular peptide (PTH2) (NM_178449) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96A98
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.