TSSC3 (PHLDA2) (NM_003311) Human Recombinant Protein

TSSC3 protein,

Product Info Summary

SKU: PROTQ53GA4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TSSC3 (PHLDA2) (NM_003311) Human Recombinant Protein

View all TSSC3 recombinant proteins

SKU/Catalog Number

PROTQ53GA4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human pleckstrin homology-like domain, family A, member 2 (PHLDA2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TSSC3 (PHLDA2) (NM_003311) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ53GA4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.9 kDa

Amino Acid Sequence

MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP

Validation Images & Assay Conditions

Gene/Protein Information For PHLDA2 (Source: Uniprot.org, NCBI)

Gene Name

PHLDA2

Full Name

Pleckstrin homology-like domain family A member 2

Weight

16.9 kDa

Superfamily

PHLDA2 family

Alternative Names

Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein; BWR1Cp17-Beckwith-Wiedemann region 1 C; HLDA2BRW1C; Imprinted in placenta and liver protein; IPLp17-BWR1C; pleckstrin homology-like domain family A member 2; pleckstrin homology-like domain, family A, member 2; TSSC3p17-Beckwith-Wiedemann region 1C; tumor suppressing subchromosomal transferable fragment cDNA 3; tumor suppressing subtransferable candidate 3; Tumor-suppressing STF cDNA 3 protein; Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein; tumor-supressing STF cDNA 3 PHLDA2 BRW1C, BWR1C, HLDA2, IPL, TSSC3 pleckstrin homology like domain family A member 2 pleckstrin homology-like domain family A member 2|beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein|imprinted in placenta and liver protein|p17-BWR1C|p17-Beckwith-Wiedemann region 1 C|p17-Beckwith-Wiedemann region 1C|tumor suppressing subchromosomal transferable fragment cDNA 3|tumor suppressing subtransferable candidate 3|tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein|tumor-supressing STF cDNA 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PHLDA2, check out the PHLDA2 Infographic

PHLDA2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PHLDA2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ53GA4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TSSC3 (PHLDA2) (NM_003311) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TSSC3 (PHLDA2) (NM_003311) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TSSC3 (PHLDA2) (NM_003311) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ53GA4
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.