Tspan 13 (TSPAN13) (NM_014399) Human Recombinant Protein

TSPAN13 protein,

Recombinant protein of human tetraspanin 13 (TSPAN13)

Product Info Summary

SKU: PROTO95857
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Tspan 13 (TSPAN13) (NM_014399) Human Recombinant Protein

View all TSPAN13 recombinant proteins

SKU/Catalog Number

PROTO95857

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tetraspanin 13 (TSPAN13)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Tspan 13 (TSPAN13) (NM_014399) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95857)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22 kDa

Amino Acid Sequence

MVCGGFACSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIALVGLIGAVKHHQVLLFFYMIILLLVFIVQFSVSCACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEVLRFVGGIGLFFSFTEILGVWLTYRYRNQKDPRANPSAFL

Validation Images & Assay Conditions

Gene/Protein Information For TSPAN13 (Source: Uniprot.org, NCBI)

Gene Name

TSPAN13

Full Name

Tetraspanin-13

Weight

22 kDa

Superfamily

tetraspanin (TM4SF) family

Alternative Names

FLJ22934; NET-6; NET6transmembrane 4 superfamily member tetraspan NET-6; Tetraspan NET-6; tetraspanin 13; TM4SF13; Transmembrane 4 superfamily member 13tetraspanin-13; TSPAN13; TSPAN-13 TSPAN13 NET-6, NET6, TM4SF13 tetraspanin 13 tetraspanin-13|tetraspan NET-6|transmembrane 4 superfamily member 13|transmembrane 4 superfamily member tetraspan NET-6|tspan-13

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TSPAN13, check out the TSPAN13 Infographic

TSPAN13 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TSPAN13: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO95857

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Tspan 13 (TSPAN13) (NM_014399) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Tspan 13 (TSPAN13) (NM_014399) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Tspan 13 (TSPAN13) (NM_014399) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95857
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.