TRK fused gene (TFG) (NM_001007565) Human Recombinant Protein

TFG protein,

Recombinant protein of human TRK-fused gene (TFG), transcript variant 2

Product Info Summary

SKU: PROTQ92734
Size: 20 µg
Source: HEK293T

Product Name

TRK fused gene (TFG) (NM_001007565) Human Recombinant Protein

View all TFG recombinant proteins

SKU/Catalog Number

PROTQ92734

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human TRK-fused gene (TFG), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TRK fused gene (TFG) (NM_001007565) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ92734)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

43.3 kDa

Amino Acid Sequence

MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQIEGQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQTGPQQPQQFQGYGQQPTSQAPAPAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR

Validation Images & Assay Conditions

Gene/Protein Information For TFG (Source: Uniprot.org, NCBI)

Gene Name

TFG

Full Name

Protein TFG

Weight

43.3 kDa

Alternative Names

FLJ36137; protein TFG; TF6; TRK-fused gene protein; TRK-fused gene; TRKT3 oncogene; TRKT3 TFG HMSNP, SPG57, TF6, TRKT3 trafficking from ER to golgi regulator protein TFG|TRK-fused|TRK-fused gene protein|TRKT3 oncogene

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TFG, check out the TFG Infographic

TFG infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TFG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ92734

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TRK fused gene (TFG) (NM_001007565) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TRK fused gene (TFG) (NM_001007565) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TRK fused gene (TFG) (NM_001007565) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ92734
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.