Click image to see more details
Product Info Summary
| SKU: | A04058 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Myoglobin/MB Antibody Picoband®
SKU/Catalog Number
A04058
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Myoglobin/MB Antibody Picoband® catalog # A04058. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Myoglobin/MB Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04058)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Myoglobin, different from the related mouse sequence by three amino acids, and from the related rat sequence by six amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A04058 is reactive to MB in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
17 kDa
Calculated molecular weight
17184 MW
Background of Myoglobin
Myoglobin (MB) also known as PVALB, is a single-chain globular protein of 153 or 154 amino acids, containing a heme (iron-containing porphyrin) prosthetic group in the center around which the remaining apoprotein folds. It is a member of the globin superfamily and is expressed in skeletal and cardiac muscles. This gene is mapped to chromosome 22q11-q13. Myoglobin is released from damaged muscle tissue (rhabdomyolysis), which has very high concentrations of myoglobin. The released myoglobin is filtered by the kidneys but is toxic to the renal tubular epithelium and so may cause acute renal failure.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A04058 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry, 2-5μg/ml, Human, Mouse, Rat
Positive Control
WB: rat heart tissue, rat skeletal muscle tissue, mouse heart tissue, mouse skeletal muscle tissue, rat liver tissue, mouse liver tissue
IHC: mouse skeletal muscle tissue, rat skeletal muscle tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Myoglobin using anti-Myoglobin antibody (A04058).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: rat heart tissue lysates,
Lane 2: rat skeletal muscle tissue lysates,
Lane 3: mouse heart tissue lysates,
Lane 4: mouse skeletal muscle tissue lysates,
Lane 5: rat liver tissue lysates,
Lane 6: mouse liver tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Myoglobin antigen affinity purified polyclonal antibody (Catalog # A04058) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Myoglobin at approximately 17 kDa. The expected band size for Myoglobin is at 17 kDa.
Click image to see more details
Figure 2. IHC analysis of Myoglobin using anti-Myoglobin antibody (A04058).
Myoglobin was detected in a paraffin-embedded section of mouse skeletal muscle tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-Myoglobin Antibody (A04058) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of Myoglobin using anti-Myoglobin antibody (A04058).
Myoglobin was detected in a paraffin-embedded section of rat skeletal muscle tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-Myoglobin Antibody (A04058) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For MB (Source: Uniprot.org, NCBI)
Gene Name
MB
Full Name
Myoglobin
Weight
17184 MW
Superfamily
globin family
Alternative Names
Myoglobin;MB; MB PVALB myoglobin myoglobin
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on MB, check out the MB Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for MB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Myoglobin/MB Antibody Picoband® (A04058)
Hello CJ!
No publications found for A04058
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Myoglobin/MB Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Myoglobin/MB Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
13 Customer Q&As for Anti-Myoglobin/MB Antibody Picoband®
Question
We are currently using anti-Myoglobin/MB antibody A04058 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on goat tissues as well?
Verified Customer
Verified customer
Asked: 2020-02-27
Answer
The anti-Myoglobin/MB antibody (A04058) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-02-27
Question
I have a question about product A04058, anti-Myoglobin/MB antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2020-01-07
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04058 anti-Myoglobin/MB antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-01-07
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for heart using anti-Myoglobin/MB antibody A04058. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-11-26
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-11-26
Question
Will A04058 anti-Myoglobin/MB antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-11-06
Answer
As indicated on the product datasheet, A04058 anti-Myoglobin/MB antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-11-06
Question
Does anti-Myoglobin/MB antibody A04058 work for WB with heart?
Verified Customer
Verified customer
Asked: 2019-07-26
Answer
According to the expression profile of heart, MB is highly expressed in heart. So, it is likely that anti-Myoglobin/MB antibody A04058 will work for WB with heart.
Boster Scientific Support
Answered: 2019-07-26
Question
I see that the anti-Myoglobin/MB antibody A04058 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-07-10
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-07-10
Question
Is this A04058 anti-Myoglobin/MB antibody reactive to the isotypes of MB?
Verified Customer
Verified customer
Asked: 2019-06-20
Answer
The immunogen of A04058 anti-Myoglobin/MB antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Myoglobin (3-35aa LSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFK), different from the related mouse sequence by three amino acids, and from the related rat sequence by six amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-06-20
Question
I was wanting to use to test anti-Myoglobin/MB antibody A04058 on human heart for research purposes, then I may be interested in using anti-Myoglobin/MB antibody A04058 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
K. Kulkarni
Verified customer
Asked: 2018-10-09
Answer
The products we sell, including anti-Myoglobin/MB antibody A04058, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-10-09
Question
See below the WB image, lot number and protocol we used for heart using anti-Myoglobin/MB antibody A04058. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2017-08-14
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-08-14
Question
Do you have a BSA free version of anti-Myoglobin/MB antibody A04058 available?
J. Walker
Verified customer
Asked: 2014-10-30
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Myoglobin/MB antibody A04058 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2014-10-30
Question
Is a blocking peptide available for product anti-Myoglobin/MB antibody (A04058)?
C. Anderson
Verified customer
Asked: 2014-05-01
Answer
We do provide the blocking peptide for product anti-Myoglobin/MB antibody (A04058). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2014-05-01
Question
I am interested in using your anti-Myoglobin/MB antibody for response to hydrogen peroxide studies. Has this antibody been tested with western blotting on hepg2 whole cell lysate? We would like to see some validation images before ordering.
O. Anderson
Verified customer
Asked: 2014-04-11
Answer
Thanks for your inquiry. This A04058 anti-Myoglobin/MB antibody is tested on human hela, hepg2 whole cell lysate, hela whole cell lysate, jurkat whole cell lysate. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2014-04-11
Question
We have observed staining in human heart right ventricle. Do you have any suggestions? Is anti-Myoglobin/MB antibody supposed to stain heart right ventricle positively?
B. Wu
Verified customer
Asked: 2014-01-07
Answer
From literature heart right ventricle does express MB. From Uniprot.org, MB is expressed in heart right ventricle, skeletal muscle, heart, among other tissues. Regarding which tissues have MB expression, here are a few articles citing expression in various tissues:
Heart, Pubmed ID: 7895732
Skeletal muscle, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2014-01-07
