TRIM44 (NM_017583) Human Recombinant Protein

TRIM44 protein,

Recombinant protein of human tripartite motif-containing 44 (TRIM44)

Product Info Summary

SKU: PROTQ96DX7
Size: 20 µg
Source: HEK293T

Product Name

TRIM44 (NM_017583) Human Recombinant Protein

View all TRIM44 recombinant proteins

SKU/Catalog Number

PROTQ96DX7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tripartite motif-containing 44 (TRIM44)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TRIM44 (NM_017583) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96DX7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

38.3 kDa

Amino Acid Sequence

MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEYVHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT

Validation Images & Assay Conditions

Gene/Protein Information For TRIM44 (Source: Uniprot.org, NCBI)

Gene Name

TRIM44

Full Name

Tripartite motif-containing protein 44

Weight

38.3 kDa

Alternative Names

DIPBMGC3490; HSA249128; MC7; Protein DIPB; tripartite motif containing 44; tripartite motif-containing 44; tripartite motif-containing protein 44 TRIM44 AN3, DIPB, HSA249128, MC7 tripartite motif containing 44 tripartite motif-containing protein 44

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TRIM44, check out the TRIM44 Infographic

TRIM44 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TRIM44: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96DX7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TRIM44 (NM_017583) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TRIM44 (NM_017583) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TRIM44 (NM_017583) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96DX7
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.