TRAPPC6A (NM_024108) Human Recombinant Protein

Trappc6a protein,

Recombinant protein of human trafficking protein particle complex 6A (TRAPPC6A)

Product Info Summary

SKU: PROTO75865
Size: 20 µg
Source: HEK293T

Product Name

TRAPPC6A (NM_024108) Human Recombinant Protein

View all Trappc6a recombinant proteins

SKU/Catalog Number

PROTO75865

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human trafficking protein particle complex 6A (TRAPPC6A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TRAPPC6A (NM_024108) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO75865)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.8 kDa

Amino Acid Sequence

MADTVLFEFLHTEMVAELWAHDPDPGPGVSAGLRGEEAGATKGQKMSLSVLEGMGFRVGQALGERLPRETLAFREELDVLKFLCKDLWVAVFQKQMDSLRTNHQGTYVLQDNSFPLLLPMASGLQYLEEAPKFLAFTCGLLRGALYTLGIESVVTASVAALPVCKFQVVIPKS

Validation Images & Assay Conditions

Gene/Protein Information For Trappc6a (Source: Uniprot.org, NCBI)

Gene Name

Trappc6a

Full Name

Trafficking protein particle complex subunit 6A

Weight

18.8 kDa

Superfamily

TRAPP small subunits family

Alternative Names

HSPC289; MGC2650; trafficking protein particle complex 6A; trafficking protein particle complex subunit 6A; TRAPP complex subunit 6A; TRAPPC6Adelta29-42; TRS33

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Trappc6a, check out the Trappc6a Infographic

Trappc6a infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Trappc6a: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO75865

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TRAPPC6A (NM_024108) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TRAPPC6A (NM_024108) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TRAPPC6A (NM_024108) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO75865
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.