TRAPPC3 (NM_014408) Human Recombinant Protein

TRAPPC3 protein,

Product Info Summary

SKU: PROTO43617
Size: 20 µg
Source: HEK293T

Product Name

TRAPPC3 (NM_014408) Human Recombinant Protein

View all TRAPPC3 recombinant proteins

SKU/Catalog Number

PROTO43617

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human trafficking protein particle complex 3 (TRAPPC3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TRAPPC3 (NM_014408) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43617)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.1 kDa

Amino Acid Sequence

MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE

Validation Images & Assay Conditions

Gene/Protein Information For TRAPPC3 (Source: Uniprot.org, NCBI)

Gene Name

TRAPPC3

Full Name

Trafficking protein particle complex subunit 3

Weight

20.1 kDa

Superfamily

TRAPP small subunits family

Alternative Names

1110058K12Rik; BET3BET3 homolog; trafficking protein particle complex 3; trafficking protein particle complex subunit 3,1110058K12Rik TRAPPC3 BET3 trafficking protein particle complex subunit 3 trafficking protein particle complex subunit 3|trafficking protein particle complex 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TRAPPC3, check out the TRAPPC3 Infographic

TRAPPC3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TRAPPC3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used TRAPPC3 (NM_014408) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TRAPPC3 (NM_014408) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TRAPPC3 (NM_014408) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO43617
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.