ERGIC3 (NM_015966) Human Recombinant Protein

ERGI3 protein,

Product Info Summary

SKU: PROTQ9Y282
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ERGIC3 (NM_015966) Human Recombinant Protein

View all ERGI3 recombinant proteins

SKU/Catalog Number

PROTQ9Y282

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ERGIC and golgi 3 (ERGIC3), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ERGIC3 (NM_015966) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y282)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

43 kDa

Amino Acid Sequence

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT

Validation Images & Assay Conditions

Gene/Protein Information For ERGIC3 (Source: Uniprot.org, NCBI)

Gene Name

ERGIC3

Full Name

Endoplasmic reticulum-Golgi intermediate compartment protein 3

Weight

43 kDa

Superfamily

ERGIC family

Alternative Names

C20orf47; CGI-54; chromosome 20 open reading frame 47; dJ477O4.2; endoplasmic reticulum-Golgi intermediate compartment protein 3; endoplasmic reticulum-localized protein ERp43; ERGIC and golgi 3; Erv46; NY-BR-84; PRO0989; SDBCAG84; serologically defined breast cancer antigen 84; Serologically defined breast cancer antigen NY-BR-84 ERGIC3 C20orf47, C2orf47, CGI-54, Erv46, NY-BR-84, PRO0989, SDBCAG84, dJ477O4.2 ERGIC and golgi 3 endoplasmic reticulum-Golgi intermediate compartment protein 3|endoplasmic reticulum-localized protein ERp43|serologically defined breast cancer 84|serologically defined breast cancer NY-BR-84

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ERGIC3, check out the ERGIC3 Infographic

ERGIC3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ERGIC3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y282

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ERGIC3 (NM_015966) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ERGIC3 (NM_015966) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ERGIC3 (NM_015966) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y282
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.