TPM4 (NM_003290) Human Recombinant Protein

tropomyosin-4 protein,

Product Info Summary

SKU: PROTP67936
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TPM4 (NM_003290) Human Recombinant Protein

View all tropomyosin-4 recombinant proteins

SKU/Catalog Number

PROTP67936

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tropomyosin 4 (TPM4), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TPM4 (NM_003290) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP67936)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

28.3 kDa

Amino Acid Sequence

MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLFEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI

Validation Images & Assay Conditions

Gene/Protein Information For TPM4 (Source: Uniprot.org, NCBI)

Gene Name

TPM4

Full Name

Tropomyosin alpha-4 chain

Weight

28.3 kDa

Superfamily

tropomyosin family

Alternative Names

TM30p1; tropomyosin 4; tropomyosin alpha-4 chain; tropomyosin-4 TPM4 HEL-S-108 tropomyosin 4 tropomyosin alpha-4 chain|TM30p1|epididymis secretory protein Li 108

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TPM4, check out the TPM4 Infographic

TPM4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TPM4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used TPM4 (NM_003290) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TPM4 (NM_003290) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TPM4 (NM_003290) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP67936
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.