TOB2 (NM_016272) Human Recombinant Protein

TOB2 protein,

Purified recombinant protein of Homo sapiens transducer of ERBB2, 2 (TOB2)

Product Info Summary

SKU: PROTQ14106
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TOB2 (NM_016272) Human Recombinant Protein

View all TOB2 recombinant proteins

SKU/Catalog Number

PROTQ14106

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens transducer of ERBB2, 2 (TOB2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TOB2 (NM_016272) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ14106)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.5 kDa

Amino Acid Sequence

MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGAVKVLYLDDSEGCGAPELDKEIKSSFNPDAQVFVPIGSQDSSLSNSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMKKGGGAASGGGVASSGAGGQQPPQQPRMARSPTNSLLKHKSLSLSMHSLNFITANPAPQSQLSPNAKEFVYNGGGSPSLFFDAADGQGSGTPGPFGGSGAGTCNSSSFDMAQVFGGGANSLFLEKTPFVEGLSYNLNTMQYPSQQFQPVVLAN

Validation Images & Assay Conditions

Gene/Protein Information For TOB2 (Source: Uniprot.org, NCBI)

Gene Name

TOB2

Full Name

Protein Tob2

Weight

36.5 kDa

Superfamily

BTG family

Alternative Names

bK223H9; protein Tob2; Protein Tob4; TOB4KIAA1663; TOBL; Transducer of erbB-2 2; transducer of ERBB2, 2; TROB2 TOB2 APRO5, TOB4, TOBL, TROB2 transducer of ERBB2, 2 protein Tob2|protein Tob4|transducer of erbB-2 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TOB2, check out the TOB2 Infographic

TOB2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TOB2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ14106

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TOB2 (NM_016272) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TOB2 (NM_016272) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TOB2 (NM_016272) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ14106
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.