TMCO1 (NM_019026) Human Recombinant Protein

TMCO1 protein,

Recombinant protein of human transmembrane and coiled-coil domains 1 (TMCO1)

Product Info Summary

SKU: PROTQ9UM00
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TMCO1 (NM_019026) Human Recombinant Protein

View all TMCO1 recombinant proteins

SKU/Catalog Number

PROTQ9UM00

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human transmembrane and coiled-coil domains 1 (TMCO1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TMCO1 (NM_019026) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UM00)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21 kDa

Amino Acid Sequence

MSTMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFTPLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS

Validation Images & Assay Conditions

Gene/Protein Information For TMCO1 (Source: Uniprot.org, NCBI)

Gene Name

TMCO1

Full Name

Calcium load-activated calcium channel

Weight

21 kDa

Superfamily

TMCO1 family

Alternative Names

HP10122; PCIA3; PNAS-136; putative membrane protein; RP11-466F5.7; TMCC4; transmembrane and coiled-coil domain-containing protein 1; transmembrane and coiled-coil domains 1; transmembrane and coiled-coil domains 4; Transmembrane and coiled-coil domains protein 4; Xenogeneic cross-immune protein PCIA3 TMCO1 HP10122, PCIA3, PNAS-136, TMCC4 transmembrane and coiled-coil domains 1 calcium load-activated calcium channel|CLAC channel|Ca(2+) load-activated Ca(2+) channel|putative membrane protein|transmembrane and coiled-coil domain-containing protein 1|transmembrane and coiled-coil domains 4|xenogeneic cross-immune protein PCIA3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TMCO1, check out the TMCO1 Infographic

TMCO1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TMCO1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UM00

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TMCO1 (NM_019026) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TMCO1 (NM_019026) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TMCO1 (NM_019026) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UM00
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.