THOC7 (NM_025075) Human Recombinant Protein

Thoc7 protein,

Product Info Summary

SKU: PROTQ6I9Y2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

THOC7 (NM_025075) Human Recombinant Protein

View all Thoc7 recombinant proteins

SKU/Catalog Number

PROTQ6I9Y2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human THO complex 7 homolog (Drosophila) (THOC7)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

THOC7 (NM_025075) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6I9Y2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.6 kDa

Amino Acid Sequence

MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP

Validation Images & Assay Conditions

Gene/Protein Information For THOC7 (Source: Uniprot.org, NCBI)

Gene Name

THOC7

Full Name

THO complex subunit 7 homolog

Weight

23.6 kDa

Superfamily

THOC7 family

Alternative Names

FLJ23445; fSAP24NIF3L1-binding protein 1; Functional spliceosome-associated protein 24; Ngg1 interacting factor 3 like 1 binding protein 1; Ngg1-interacting factor 3-like protein 1-binding protein 1; NIF3L1BP1hTREX30; THO complex 7 homolog (Drosophila); THO complex subunit 7 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on THOC7, check out the THOC7 Infographic

THOC7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for THOC7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used THOC7 (NM_025075) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For THOC7 (NM_025075) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for THOC7 (NM_025075) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6I9Y2
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.