Product Info Summary
SKU: | PROTP26891-1 |
---|---|
Size: | 5ug,20ug |
Origin Species: | Swine |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Swine recombinant IL-2 (Interleukin-2) protein, AF
View all IL-2 recombinant proteins
SKU/Catalog Number
PROTP26891-1
Size
5ug,20ug
Tag
His Tag (C-term)
Description
Interleukin-2 (IL-2) is a four bundle, immuno-modulatory cytokine which is expressed predominately by antigen-simulated CD4+ T cells, CD8+ T cells, natural killer (NK) cells, and dendritic cells (DC). IL-2 plays a fundamental role in promoting NK cell proliferation, cytotoxicity, and B cells differentiation. IL-2 modulate T cell differentiation programs, promoting na?ve CD4+ T cell differentiation into T helper-1 (Th1) and T helper-2 (Th2) cells.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Swine recombinant IL-2 (Interleukin-2) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP26891-1)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
17.628kDa
Molecular weight
The protein has a calculated MW of 16.2 kDa. The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce proliferation in CTLL2 cells. The ED₅₀ for this effect is 0.5 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MAPTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRMLTFKFYMPKQATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKGSETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT with polyhistidine tag at the C-terminus
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant swine IL-2
Protein Target Info & Infographic
Gene/Protein Information For IL2 (Source: Uniprot.org, NCBI)
Gene Name
IL2
Full Name
Interleukin-2
Weight
17.628kDa
Superfamily
IL-2 family
Alternative Names
T-cell Growth Factor (TCGF), Aldesleukin, POIL2 IL2 IL-2, TCGF, lymphokine interleukin 2 interleukin-2|T cell growth factor|aldesleukin|involved in regulation of T-cell clonal expansion
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL2, check out the IL2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Swine recombinant IL-2 (Interleukin-2) protein, AF (PROTP26891-1)
Hello CJ!
No publications found for PROTP26891-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Swine recombinant IL-2 (Interleukin-2) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Swine recombinant IL-2 (Interleukin-2) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question