Swine recombinant CXCL13 (C-X-C motif chemokine 13) protein, AF

CXCL13/BLC/BCA-1 protein, Swine

C-X-C motif chemokine 13 (CXCL13) also named B lymphocyte chemoattractant (BLC), which is a chemokine of the intercrine alpha family. CXCL13 is a 9.8kDa protein containing 88 amino acid residues. CXCL13 is a chemotaxis for B lymphocyte. CXCL13 induces the cell proliferation though the AKT signal pathway which plays an key role intestinal cancer model. CXCL13 /CXCR5 axis is highly existed in gut, spleen and lymph nodes.

Product Info Summary

SKU: PROTA0A287A706
Size: 5ug,20ug
Origin Species: Swine
Source: Escherichia coli
Application: Cell Culture

Product Name

Swine recombinant CXCL13 (C-X-C motif chemokine 13) protein, AF

View all CXCL13/BLC/BCA-1 recombinant proteins

SKU/Catalog Number

PROTA0A287A706

Size

5ug,20ug

Tag

His Tag (N-term)

Description

C-X-C motif chemokine 13 (CXCL13) also named B lymphocyte chemoattractant (BLC), which is a chemokine of the intercrine alpha family. CXCL13 is a 9.8kDa protein containing 88 amino acid residues. CXCL13 is a chemotaxis for B lymphocyte. CXCL13 induces the cell proliferation though the AKT signal pathway which plays an key role intestinal cancer model. CXCL13 /CXCR5 axis is highly existed in gut, spleen and lymph nodes.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Swine recombinant CXCL13 (C-X-C motif chemokine 13) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA0A287A706)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

12.664kDa

Molecular weight

The protein has a calculated MW of 10.81 kDa. The protein migrates about 11 kDa under reducing condition (SDS-PAGE analysis).

Activity

Testing in process

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

VLETNDTNLKCQCLRSTSNWVPIRLIEKIQIWPPGNGCPTREVIVWMTNKTAICLNPQSKLLQKLINLMWRKKTSTTLPAPVSKKSIA with polyhistidine tag at the N-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For CXCL13 (Source: Uniprot.org, NCBI)

Gene Name

CXCL13

Full Name

C-X-C motif chemokine 13

Weight

12.664kDa

Superfamily

intercrine alpha (chemokine CxC) family

Alternative Names

ANGIE; ANGIE2; B cell-attracting chemokine 1; B lymphocyte chemoattractant; BCA1; BCA-1; BCA1B-cell chemoattractant; BCA-1CXC chemokine BLC; B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1); BLC; BLCSmall-inducible cytokine B13; BLR1L; B-lymphocyte chemoattractant; chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant); chemokine (C-X-C motif) ligand 13; C-X-C motif chemokine 13; CXCL13; SCYB13; SCYB13B-cell-attracting chemokine 1; small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cellchemoattractant) CXCL13 ANGIE, ANGIE2, BCA-1, BCA1, BLC, BLR1L, SCYB13 C-X-C motif chemokine ligand 13 C-X-C motif chemokine 13|B-cell chemoattractant|B-cell-attracting chemokine 1|B-cell-homing chemokine (ligand for Burkitts lymphoma receptor-1)|B-lymphocyte chemoattractant|CXC chemokine BLC|b cell-attracting chemokine 1|b lymphocyte chemoattractant|chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant)|small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant)|small-inducible cytokine B13

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CXCL13, check out the CXCL13 Infographic

CXCL13 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CXCL13: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTA0A287A706

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Swine recombinant CXCL13 (C-X-C motif chemokine 13) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Swine recombinant CXCL13 (C-X-C motif chemokine 13) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Swine recombinant CXCL13 (C-X-C motif chemokine 13) protein, AF

Size

Total: $154

SKU:PROTA0A287A706

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTA0A287A706
$154.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.