Swine recombinant CCL2 (C-C Motif Chemokine Ligand 2) protein, AF

CCL2 protein, Swine

CCL2 (Chemokine ligand 2) is also named for the MCP1 (monocyte chemoattractant protein 1) which is a cytokine of CC chemokine family. CCL2 plays an important role in the recruitment of T cell and monocyte during inflammation, which is induced by the infection. CCL2 is secreted from the osteoblasts which is under the mediation of the NF-κB pathway. In cancer therapy, CCL2 plays an important role in increasing the anti-tumor capability of monocytes and neutrophils.

Product Info Summary

SKU: PROTP42831
Size: 5ug,20ug
Origin Species: Swine
Source: Escherichia coli
Application: Cell Culture

Product Name

Swine recombinant CCL2 (C-C Motif Chemokine Ligand 2) protein, AF

View all CCL2 recombinant proteins

SKU/Catalog Number

PROTP42831

Size

5ug,20ug

Tag

His Tag (N-term)

Description

CCL2 (Chemokine ligand 2) is also named for the MCP1 (monocyte chemoattractant protein 1) which is a cytokine of CC chemokine family. CCL2 plays an important role in the recruitment of T cell and monocyte during inflammation, which is induced by the infection. CCL2 is secreted from the osteoblasts which is under the mediation of the NF-κB pathway. In cancer therapy, CCL2 plays an important role in increasing the anti-tumor capability of monocytes and neutrophils.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Swine recombinant CCL2 (C-C Motif Chemokine Ligand 2) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP42831)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

11.025kDa

Molecular weight

The protein has a calculated MW of 9.42 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).

Activity

Testing in process

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

QPDAINSPVTCCYTLTSKKISMQRLMSYRRVTSSKCPKEAVIFKTIAGKEICAEPKQKWVQDSISHLDKKNQTPKP with polyhistidine tag at the N-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For CCL2 (Source: Uniprot.org, NCBI)

Gene Name

CCL2

Full Name

C-C motif chemokine 2

Weight

11.025kDa

Superfamily

intercrine beta (chemokine CC) family

Alternative Names

MCP-1 CCL2 GDCF-2, HC11, HSMCR30, MCAF, MCP-1, MCP1, SCYA2, SMC-CF C-C motif chemokine ligand 2 C-C motif chemokine 2|chemokine (C-C motif) ligand 2|monocyte chemoattractant protein-1|monocyte chemotactic and activating factor|monocyte chemotactic protein 1|monocyte secretory protein JE|small inducible cytokine A2 (monocyte chemotactic protein 1, homologous to mouse Sig-je)|small inducible cytokine subfamily A (Cys-Cys), member 2|small-inducible cytokine A2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CCL2, check out the CCL2 Infographic

CCL2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CCL2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP42831

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Swine recombinant CCL2 (C-C Motif Chemokine Ligand 2) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Swine recombinant CCL2 (C-C Motif Chemokine Ligand 2) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Swine recombinant CCL2 (C-C Motif Chemokine Ligand 2) protein, AF

Size

Total: $154

SKU:PROTP42831

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP42831
$154.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product