Product Info Summary
SKU: | PROTP42831 |
---|---|
Size: | 5ug,20ug |
Origin Species: | Swine |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Swine recombinant CCL2 (C-C Motif Chemokine Ligand 2) protein, AF
View all CCL2 recombinant proteins
SKU/Catalog Number
PROTP42831
Size
5ug,20ug
Tag
His Tag (N-term)
Description
CCL2 (Chemokine ligand 2) is also named for the MCP1 (monocyte chemoattractant protein 1) which is a cytokine of CC chemokine family. CCL2 plays an important role in the recruitment of T cell and monocyte during inflammation, which is induced by the infection. CCL2 is secreted from the osteoblasts which is under the mediation of the NF-κB pathway. In cancer therapy, CCL2 plays an important role in increasing the anti-tumor capability of monocytes and neutrophils.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Swine recombinant CCL2 (C-C Motif Chemokine Ligand 2) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP42831)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
11.025kDa
Molecular weight
The protein has a calculated MW of 9.42 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Activity
Testing in process
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
QPDAINSPVTCCYTLTSKKISMQRLMSYRRVTSSKCPKEAVIFKTIAGKEICAEPKQKWVQDSISHLDKKNQTPKP with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant swine CCL2
Protein Target Info & Infographic
Gene/Protein Information For CCL2 (Source: Uniprot.org, NCBI)
Gene Name
CCL2
Full Name
C-C motif chemokine 2
Weight
11.025kDa
Superfamily
intercrine beta (chemokine CC) family
Alternative Names
MCP-1 CCL2 GDCF-2, HC11, HSMCR30, MCAF, MCP-1, MCP1, SCYA2, SMC-CF C-C motif chemokine ligand 2 C-C motif chemokine 2|chemokine (C-C motif) ligand 2|monocyte chemoattractant protein-1|monocyte chemotactic and activating factor|monocyte chemotactic protein 1|monocyte secretory protein JE|small inducible cytokine A2 (monocyte chemotactic protein 1, homologous to mouse Sig-je)|small inducible cytokine subfamily A (Cys-Cys), member 2|small-inducible cytokine A2
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CCL2, check out the CCL2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CCL2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Swine recombinant CCL2 (C-C Motif Chemokine Ligand 2) protein, AF (PROTP42831)
Hello CJ!
No publications found for PROTP42831
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Swine recombinant CCL2 (C-C Motif Chemokine Ligand 2) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Swine recombinant CCL2 (C-C Motif Chemokine Ligand 2) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question