SURF5 (MED22) (NM_181491) Human Recombinant Protein

SURF5 protein,

Recombinant protein of human mediator complex subunit 22 (MED22), transcript variant c

Product Info Summary

SKU: PROTQ15528
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SURF5 (MED22) (NM_181491) Human Recombinant Protein

View all SURF5 recombinant proteins

SKU/Catalog Number

PROTQ15528

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mediator complex subunit 22 (MED22), transcript variant c

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SURF5 (MED22) (NM_181491) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15528)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.3 kDa

Amino Acid Sequence

MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYK

Validation Images & Assay Conditions

Gene/Protein Information For MED22 (Source: Uniprot.org, NCBI)

Gene Name

MED22

Full Name

Mediator of RNA polymerase II transcription subunit 22

Weight

16.3 kDa

Superfamily

Mediator complex subunit 22 family

Alternative Names

Med24; mediator complex subunit 22SURF5surfeit 5; mediator of RNA polymerase II transcription subunit 22; MGC48682; surf-5; Surfeit locus protein 5 MED22 MED24, SRB6, SURF5, surf-5 mediator complex subunit 22 mediator of RNA polymerase II transcription subunit 22|surfeit locus protein 5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MED22, check out the MED22 Infographic

MED22 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MED22: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ15528

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SURF5 (MED22) (NM_181491) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SURF5 (MED22) (NM_181491) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SURF5 (MED22) (NM_181491) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ15528
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.