Sumo 2 (SUMO2) (NM_001005849) Human Recombinant Protein

Sumo2 protein,

Product Info Summary

SKU: PROTP61956
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Sumo 2 (SUMO2) (NM_001005849) Human Recombinant Protein

View all Sumo2 recombinant proteins

SKU/Catalog Number

PROTP61956

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Sumo 2 (SUMO2) (NM_001005849) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP61956)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

7.9 kDa

Amino Acid Sequence

MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQLEMEDEDTIDVFQQQTGGVY

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For SUMO2 (Source: Uniprot.org, NCBI)

Gene Name

SUMO2

Full Name

Small ubiquitin-related modifier 2

Weight

7.9 kDa

Superfamily

ubiquitin family

Alternative Names

HSMT3; small ubiquitin-like modifier 2; SMT3A; SMT3B; SMT3H2; SUMO2; SUMO2/3; SUMO3 SUMO2 HSMT3, SMT3B, SMT3H2, SUMO3, Smt3A small ubiquitin like modifier 2 small ubiquitin-related modifier 2|SMT3 homolog 2|SMT3 suppressor of mif two 3 homolog 2|sentrin 2|ubiquitin-like protein SMT3A|ubiquitin-like protein SMT3B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SUMO2, check out the SUMO2 Infographic

SUMO2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SUMO2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP61956

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Sumo 2 (SUMO2) (NM_001005849) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Sumo 2 (SUMO2) (NM_001005849) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Sumo 2 (SUMO2) (NM_001005849) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP61956
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.