SULT4A1 (NM_014351) Human Recombinant Protein

Cytosolic Sulfotransferase 4A1/SULT4A1 protein,

Recombinant protein of human sulfotransferase family 4A, member 1 (SULT4A1)

Product Info Summary

SKU: PROTQ9BR01
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SULT4A1 (NM_014351) Human Recombinant Protein

View all Cytosolic Sulfotransferase 4A1/SULT4A1 recombinant proteins

SKU/Catalog Number

PROTQ9BR01

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human sulfotransferase family 4A, member 1 (SULT4A1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SULT4A1 (NM_014351) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BR01)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

32.9 kDa

Amino Acid Sequence

MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPPGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL

Validation Images & Assay Conditions

Gene/Protein Information For SULT4A1 (Source: Uniprot.org, NCBI)

Gene Name

SULT4A1

Full Name

Sulfotransferase 4A1

Weight

32.9 kDa

Superfamily

sulfotransferase 1 family

Alternative Names

Brain sulfotransferase-like protein; BRSTL1; BR-STL-1; Cytosolic Sulfotransferase 4A1; EC 2.8.2.-; hBR-STL; hBR-STL-1MGC40032; nervous system cytosolic sulfotransferase; Nervous system sulfotransferase; NST; ST4A1; sulfotransferase 4A1; sulfotransferase family 4A, member 1; sulfotransferase-related protein; SULT4A1; SULTX3; SULTX3DJ388M5.3 SULT4A1 BR-STL-1, BRSTL1, DJ388M5.3, NST, SULTX3, hBR-STL-1 sulfotransferase family 4A member 1 sulfotransferase 4A1|ST4A1|brain sulfotransferase-like protein|hBR-STL|nervous system cytosolic sulfotransferase|nervous system sulfotransferase|sulfotransferase-related protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SULT4A1, check out the SULT4A1 Infographic

SULT4A1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SULT4A1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BR01

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SULT4A1 (NM_014351) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SULT4A1 (NM_014351) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SULT4A1 (NM_014351) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BR01
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.