SULT1A2 (NM_177528) Human Recombinant Protein

SULT1A2 protein,

Product Info Summary

SKU: PROTP50226
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SULT1A2 (NM_177528) Human Recombinant Protein

View all SULT1A2 recombinant proteins

SKU/Catalog Number

PROTP50226

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2 (SULT1A2), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SULT1A2 (NM_177528) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP50226)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

34.1 kDa

Amino Acid Sequence

MELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Validation Images & Assay Conditions

Gene/Protein Information For SULT1A2 (Source: Uniprot.org, NCBI)

Gene Name

SULT1A2

Full Name

Sulfotransferase 1A2

Weight

34.1 kDa

Superfamily

sulfotransferase 1 family

Alternative Names

Aryl sulfotransferase 2; arylamine sulfotransferase; EC 2.8.2; EC 2.8.2.1; HAST4; MGC142287; MGC142289; Phenol sulfotransferase 2; phenolic-metabolizing (P) form of PST; phenol-preferring phenol sulfotransferase2; Phenol-sulfating phenol sulfotransferase 2; P-PST 2; ST1A2; STP2P-PST; sulfotransferase 1A2; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2; thermostable phenol sulfotransferase; TSPST2 SULT1A2 HAST4, P-PST, P-PST 2, ST1A2, STP2, TSPST2 sulfotransferase family 1A member 2 sulfotransferase 1A2|aryl sulfotransferase 2|arylamine sulfotransferase|phenol sulfotransferase 2|phenol-preferring phenol sulfotransferase2|phenol-sulfating phenol sulfotransferase 2|phenolic-metabolizing (P) form of PST|sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2|thermostable phenol sulfotransferase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SULT1A2, check out the SULT1A2 Infographic

SULT1A2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SULT1A2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP50226

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SULT1A2 (NM_177528) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SULT1A2 (NM_177528) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SULT1A2 (NM_177528) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP50226
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.