STAP2 (NM_001013841) Human Recombinant Protein

STAP2 protein,

Recombinant protein of human signal transducing adaptor family member 2 (STAP2), transcript variant 2

Product Info Summary

SKU: PROTQ9UGK3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

STAP2 (NM_001013841) Human Recombinant Protein

View all STAP2 recombinant proteins

SKU/Catalog Number

PROTQ9UGK3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human signal transducing adaptor family member 2 (STAP2), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

STAP2 (NM_001013841) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UGK3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

44.7 kDa

Amino Acid Sequence

MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHVEKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRNQEIKFKVETLECREMWKGFILTVVELRVPTDLTLLPGHLYMMSEVLAKEEARRALETPSCFLKVSRLEAQLLLERYPECGNLLLRPSGDGADGVSVTTRQMHNGTHVVRHYKVKREGPKYVIDVEQPFSCTSLDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPKPPVGPKPEPKVFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH

Validation Images & Assay Conditions

Gene/Protein Information For STAP2 (Source: Uniprot.org, NCBI)

Gene Name

STAP2

Full Name

Signal-transducing adaptor protein 2

Weight

44.7 kDa

Alternative Names

BKSbrk kinase substrate; Breast tumor kinase substrate; BRK substrate; FLJ20234; signal transducing adaptor family member 2; signal-transducing adaptor protein 2; signal-transducing adaptor protein-2; STAP-2 STAP2 BKS signal transducing adaptor family member 2 signal-transducing adaptor protein 2|BRK substrate|breast tumor kinase substrate|brk kinase substrate

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on STAP2, check out the STAP2 Infographic

STAP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for STAP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UGK3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used STAP2 (NM_001013841) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For STAP2 (NM_001013841) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for STAP2 (NM_001013841) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UGK3
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.