SSU72 (NM_014188) Human Recombinant Protein

SSU72 protein,

Product Info Summary

SKU: PROTQ9NP77
Size: 20 µg
Source: HEK293T

Product Name

SSU72 (NM_014188) Human Recombinant Protein

View all SSU72 recombinant proteins

SKU/Catalog Number

PROTQ9NP77

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae) (SSU72)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SSU72 (NM_014188) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NP77)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.4 kDa

Amino Acid Sequence

MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY

Validation Images & Assay Conditions

Gene/Protein Information For SSU72 (Source: Uniprot.org, NCBI)

Gene Name

SSU72

Full Name

RNA polymerase II subunit A C-terminal domain phosphatase SSU72

Weight

22.4 kDa

Superfamily

SSU72 phosphatase family

Alternative Names

CTD phosphatase SSU72; EC 3.1.3.16; FLJ13048; HSPC182; PNAS-120; RNA polymerase II subunit A C-terminal domain phosphatase SSU72; SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae); Ssu72 RNA polymerase II CTD phosphatase homolog (yeast) SSU72 HSPC182, PNAS-120 SSU72 homolog, RNA polymerase II CTD phosphatase RNA polymerase II subunit A C-terminal domain phosphatase SSU72|CTD phosphatase SSU72

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SSU72, check out the SSU72 Infographic

SSU72 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SSU72: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used SSU72 (NM_014188) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SSU72 (NM_014188) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SSU72 (NM_014188) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NP77
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.