SRP9 (NM_003133) Human Recombinant Protein

SRP9 protein,

Recombinant protein of human signal recognition particle 9kDa (SRP9), transcript variant 2

Product Info Summary

SKU: PROTP49458
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SRP9 (NM_003133) Human Recombinant Protein

View all SRP9 recombinant proteins

SKU/Catalog Number

PROTP49458

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human signal recognition particle 9kDa (SRP9), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SRP9 (NM_003133) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP49458)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

9.9 kDa

Amino Acid Sequence

MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE

Validation Images & Assay Conditions

Gene/Protein Information For SRP9 (Source: Uniprot.org, NCBI)

Gene Name

SRP9

Full Name

Signal recognition particle 9 kDa protein

Weight

9.9 kDa

Superfamily

SRP9 family

Alternative Names

ALURBP; MGC110981; signal recognition particle 9 kDa protein; signal recognition particle 9kD; signal recognition particle 9kDa SRP9 ALURBP signal recognition particle 9 signal recognition particle 9 kDa protein|signal recognition particle 9kD|signal recognition particle 9kDa

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SRP9, check out the SRP9 Infographic

SRP9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SRP9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP49458

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SRP9 (NM_003133) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SRP9 (NM_003133) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SRP9 (NM_003133) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP49458
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.