SPP1 Human, Osteopontin Human Recombinant Protein, HEK

Osteopontin/OPN protein, Human

Osteopontin Human Recombinant is a single, glycosylated, polypeptide chain produced in HEK293 cells, is a full length protein (amino acids 17-314) fused with a polyhistidine tag at the C-terminus, having a total calculated molecular mass of 34.5kDa (The actual molecular mass may be approximately 60-65kDa in SDS-PAGE under reducing conditions due to glycosylation). Osteopontin is purified by proprietary chromatographic techniques. Cited in 1 publication(s).

Product Info Summary

SKU: PROTP10451
Size: 10ug, 50ug, 1mg
Origin Species: Human
Source: HEK293

Product Name

SPP1 Human, Osteopontin Human Recombinant Protein, HEK

View all Osteopontin/OPN recombinant proteins

SKU/Catalog Number

PROTP10451

Size

10ug, 50ug, 1mg

Description

Osteopontin Human Recombinant is a single, glycosylated, polypeptide chain produced in HEK293 cells, is a full length protein (amino acids 17-314) fused with a polyhistidine tag at the C-terminus, having a total calculated molecular mass of 34.5kDa (The actual molecular mass may be approximately 60-65kDa in SDS-PAGE under reducing conditions due to glycosylation). Osteopontin is purified by proprietary chromatographic techniques.

Storage & Handling

Store at 4°C if entire vial will be used within 2-4 weeks. Store frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.

Cite This Product

SPP1 Human, Osteopontin Human Recombinant Protein, HEK (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP10451)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Osteopontin was lyophilized from a 0.2µM filtered solution of 20mM PB and 150mM NaCl, pH 7.2.

Purity

Greater than 95.0% as determined by SDS-PAGE.

Predicted MW

35.423kDa

Reconstitution

It is recommended to reconstitute the lyophilized SPP1 in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETL PSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDEL VTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDIT SHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRK ANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDS ASSEVNVDHHHHHH

Reconstitution

It is recommended to reconstitute the lyophilized SPP1 in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

Gene/Protein Information For SPP1 (Source: Uniprot.org, NCBI)

Gene Name

SPP1

Full Name

Osteopontin

Weight

35.423kDa

Superfamily

osteopontin family

Alternative Names

Secreted Phosphoprotein-1; OPN; BNSP; BSPI; ETA-1; MGC110940; SPP-1; Osteopontin; Bone sialoprotein 1; Urinary stone protein; Nephropontin; Uropontin; SPP1 SPP1 BNSP, BSPI, ETA-1, OPN secreted phosphoprotein 1 osteopontin|SPP1/CALPHA1 fusion|early T-lymphocyte activation 1|nephropontin|osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein|secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1)|secreted phosphoprotein 1 variant 6|urinary stone protein|uropontin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SPP1, check out the SPP1 Infographic

SPP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SPP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

PROTP10451 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

The role of ATG-7 contributes to pulmonary hypertension by impacting vascular remodeling

Have you used SPP1 Human, Osteopontin Human Recombinant Protein, HEK?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SPP1 Human, Osteopontin Human Recombinant Protein, HEK

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SPP1 Human, Osteopontin Human Recombinant Protein, HEK

Size

Total: $250

SKU:PROTP10451

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTP10451
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.