Product Info Summary
SKU: | PROTP10451 |
---|---|
Size: | 10ug, 50ug, 1mg |
Origin Species: | Human |
Source: | HEK293 |
Customers Who Bought This Also Bought
Product info
Product Name
SPP1 Human, Osteopontin Human Recombinant Protein, HEK
View all Osteopontin/OPN recombinant proteins
SKU/Catalog Number
PROTP10451
Size
10ug, 50ug, 1mg
Description
Osteopontin Human Recombinant is a single, glycosylated, polypeptide chain produced in HEK293 cells, is a full length protein (amino acids 17-314) fused with a polyhistidine tag at the C-terminus, having a total calculated molecular mass of 34.5kDa (The actual molecular mass may be approximately 60-65kDa in SDS-PAGE under reducing conditions due to glycosylation). Osteopontin is purified by proprietary chromatographic techniques.
Storage & Handling
Store at 4°C if entire vial will be used within 2-4 weeks. Store frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Cite This Product
SPP1 Human, Osteopontin Human Recombinant Protein, HEK (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP10451)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Osteopontin was lyophilized from a 0.2µM filtered solution of 20mM PB and 150mM NaCl, pH 7.2.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Predicted MW
35.423kDa
Reconstitution
It is recommended to reconstitute the lyophilized SPP1 in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETL PSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDEL VTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDIT SHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRK ANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDS ASSEVNVDHHHHHH
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized SPP1 in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For SPP1 (Source: Uniprot.org, NCBI)
Gene Name
SPP1
Full Name
Osteopontin
Weight
35.423kDa
Superfamily
osteopontin family
Alternative Names
Secreted Phosphoprotein-1; OPN; BNSP; BSPI; ETA-1; MGC110940; SPP-1; Osteopontin; Bone sialoprotein 1; Urinary stone protein; Nephropontin; Uropontin; SPP1 SPP1 BNSP, BSPI, ETA-1, OPN secreted phosphoprotein 1 osteopontin|SPP1/CALPHA1 fusion|early T-lymphocyte activation 1|nephropontin|osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein|secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1)|secreted phosphoprotein 1 variant 6|urinary stone protein|uropontin
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on SPP1, check out the SPP1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for SPP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For SPP1 Human, Osteopontin Human Recombinant Protein, HEK (PROTP10451)
Hello CJ!
PROTP10451 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
The role of ATG-7 contributes to pulmonary hypertension by impacting vascular remodeling
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used SPP1 Human, Osteopontin Human Recombinant Protein, HEK?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For SPP1 Human, Osteopontin Human Recombinant Protein, HEK
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question