SPATA7 (NM_001040428) Human Recombinant Protein

SPATA7 protein,

Recombinant protein of human spermatogenesis associated 7 (SPATA7), transcript variant 2

Product Info Summary

SKU: PROTQ9P0W8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SPATA7 (NM_001040428) Human Recombinant Protein

View all SPATA7 recombinant proteins

SKU/Catalog Number

PROTQ9P0W8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human spermatogenesis associated 7 (SPATA7), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SPATA7 (NM_001040428) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9P0W8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

64 kDa

Amino Acid Sequence

MDGSRRVRATSVLPRYGPPCLFKGHLSTKSNAAVDCSVPVSVSTSIKYADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNVIEGDSDPEKVEISNGLCGLNTSPSQSVQFSSVKGDNNHDMELSTLKIMEMSIEDCPLDV

Validation Images & Assay Conditions

Gene/Protein Information For SPATA7 (Source: Uniprot.org, NCBI)

Gene Name

SPATA7

Full Name

Spermatogenesis-associated protein 7

Weight

64 kDa

Alternative Names

HSD-3.1; HSD3DKFZp686D07199; LCA3; Leber congenital amaurosis 3; MGC102934; spermatogenesis associated 7; spermatogenesis-associated protein 7; Spermatogenesis-associated protein HSD3 SPATA7 HEL-S-296, HSD-3.1, HSD3, LCA3 spermatogenesis associated 7 spermatogenesis-associated protein 7|epididymis secretory protein Li 296|epididymis secretory sperm binding protein|spermatogenesis-associated protein HSD3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SPATA7, check out the SPATA7 Infographic

SPATA7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SPATA7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9P0W8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SPATA7 (NM_001040428) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SPATA7 (NM_001040428) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SPATA7 (NM_001040428) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9P0W8
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.