SPART (NM_015087) Human Recombinant Protein

SPART protein,

Recombinant protein of human spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 1

Product Info Summary

SKU: PROTQ8N0X7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SPART (NM_015087) Human Recombinant Protein

View all SPART recombinant proteins

SKU/Catalog Number

PROTQ8N0X7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SPART (NM_015087) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8N0X7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

72.7 kDa

Amino Acid Sequence

MEQEPQNGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGTGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPKLYPEFPPKDMCEKLPEPQSFSSAPQHAEVNGNTSTPSAGAVAAPASLSLPSQSCPAEAPPAYTPQAAEGHYTVSYGTDSGEFSSVGEEFYRNHSQPPPLETLGLDADELILIPNGVQIFFVNPAGEVSAPSYPGYLRIVRFLDNSLDTVLNRPPGFLQVCDWLYPLVPDRSPVLKCTAGAYMFPDTMLQAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEEENEFQIPGRTRPSSDQLKEASGTDVKQLDQGNKDVRHKGKRGKRAKDTSSEEVNLSHIVPCEPVPEEKPKELHEWSEKVAHNILSGASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIAKQATGGAAKVSQFLVDGVCTVANCVGKELAPHVKKHGSKLVPESLKKDKDGKSPLDGAMVVAASSVQGFSTVWQGLECAAKCIVNNVSAETVQTVRYKYGYNAGEATHHAVDSAVNVGVTAYNINNIGIKAMVKKTATQTGHTLLEDYQIVDNSQRENQEGAANVNVRGEKDEQTKEVKEAKKKDK

Validation Images & Assay Conditions

Gene/Protein Information For SPART (Source: Uniprot.org, NCBI)

Gene Name

SPART

Full Name

Spartin

Weight

72.7 kDa

Alternative Names

Spartin SPART SPG20, TAHCCP1 spartin spartin|spastic paraplegia 20 (Troyer syndrome)|trans-activated by hepatitis C virus core protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SPART, check out the SPART Infographic

SPART infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SPART: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8N0X7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SPART (NM_015087) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SPART (NM_015087) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SPART (NM_015087) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8N0X7
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.