SMYD2 (NM_020197) Human Recombinant Protein

SMYD2 protein,

Recombinant protein of human SET and MYND domain containing 2 (SMYD2)

Product Info Summary

SKU: PROTQ9NRG4
Size: 20 µg
Source: HEK293T

Product Name

SMYD2 (NM_020197) Human Recombinant Protein

View all SMYD2 recombinant proteins

SKU/Catalog Number

PROTQ9NRG4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human SET and MYND domain containing 2 (SMYD2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SMYD2 (NM_020197) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NRG4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

49.5 kDa

Amino Acid Sequence

MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH

Validation Images & Assay Conditions

Gene/Protein Information For SMYD2 (Source: Uniprot.org, NCBI)

Gene Name

SMYD2

Full Name

N-lysine methyltransferase SMYD2

Weight

49.5 kDa

Superfamily

class V-like SAM-binding methyltransferase superfamily

Alternative Names

EC 2.1.1.43; Histone methyltransferase SMYD2; HSKM-Bzinc finger, MYND domain containing 14; KMT3CEC 2.1.1.-; Lysine N-methyltransferase 3C; MGC119305; SET and MYND domain containing 2; SET and MYND domain-containing protein 2; ZMYND14 SMYD2 HSKM-B, KMT3C, ZMYND14 SET and MYND domain containing 2 N-lysine methyltransferase SMYD2|SET and MYND domain-containing protein 2|histone methyltransferase SMYD2|lysine N-methyltransferase 3C|zinc finger, MYND domain containing 14

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SMYD2, check out the SMYD2 Infographic

SMYD2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SMYD2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NRG4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SMYD2 (NM_020197) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SMYD2 (NM_020197) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SMYD2 (NM_020197) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NRG4
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.