SLC25A3 (NM_005888) Human Recombinant Protein

SLC25A3 protein,

Recombinant protein of human solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3 (SLC25A3), nuclear gene encoding mitochondrial protein, transcript variant 1

Product Info Summary

SKU: PROTQ00325
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SLC25A3 (NM_005888) Human Recombinant Protein

View all SLC25A3 recombinant proteins

SKU/Catalog Number

PROTQ00325

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3 (SLC25A3), nuclear gene encoding mitochondrial protein, transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SLC25A3 (NM_005888) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ00325)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

34.8 kDa

Amino Acid Sequence

MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEQYSCDYGSGRFFILCGLGGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ

Validation Images & Assay Conditions

Gene/Protein Information For SLC25A3 (Source: Uniprot.org, NCBI)

Gene Name

SLC25A3

Full Name

Phosphate carrier protein, mitochondrial

Weight

34.8 kDa

Superfamily

mitochondrial carrier (TC 2.A.29) family

Alternative Names

PHCmitochondrial phosphate carrier protein; phosphate carrier protein, mitochondrial; Phosphate transport protein; PTP; solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3; Solute carrier family 25 member 3 SLC25A3 OK/SW-cl.48, PHC, PTP solute carrier family 25 member 3 phosphate carrier protein, mitochondrial|phosphate transport protein|solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SLC25A3, check out the SLC25A3 Infographic

SLC25A3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SLC25A3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ00325

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SLC25A3 (NM_005888) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SLC25A3 (NM_005888) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SLC25A3 (NM_005888) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ00325
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.