SIRT5 (NM_012241) Human Recombinant Protein

Sirtuin 5/SIRT5 protein,

Product Info Summary

SKU: PROTQ9NXA8
Size: 20 µg
Source: HEK293T

Product Name

SIRT5 (NM_012241) Human Recombinant Protein

View all Sirtuin 5/SIRT5 recombinant proteins

SKU/Catalog Number

PROTQ9NXA8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae) (SIRT5), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SIRT5 (NM_012241) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NXA8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33.7 kDa

Amino Acid Sequence

MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS

Validation Images & Assay Conditions

Gene/Protein Information For SIRT5 (Source: Uniprot.org, NCBI)

Gene Name

SIRT5

Full Name

NAD-dependent protein deacylase sirtuin-5, mitochondrial

Weight

33.7 kDa

Superfamily

sirtuin family

Alternative Names

EC 3.5.1; EC 3.5.1.-; FLJ36950; NAD-dependent deacetylase sirtuin-5; silent mating type information regulation 2, S.cerevisiae, homolog 5; SIR2L5; sir2-like 5; SIR2-like protein 5; SIRT5; sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae); sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 5; Sirtuin 5; sirtuin type 5 SIRT5 SIR2L5 sirtuin 5 NAD-dependent protein deacylase sirtuin-5, mitochondrial|NAD-dependent deacetylase sirtuin-5|NAD-dependent lysine demalonylase and desuccinylase sirtuin-5, mitochondrial|silent mating type information regulation 2, S.cerevisiae, homolog 5|sir2-like 5|sirtuin type 5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SIRT5, check out the SIRT5 Infographic

SIRT5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SIRT5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NXA8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SIRT5 (NM_012241) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SIRT5 (NM_012241) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SIRT5 (NM_012241) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NXA8
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.