Shwachman Bodian Diamond syndrome (SBDS) (NM_016038) Human Recombinant Protein

Shwachman Bodian-Diamond syndrome protein,

Product Info Summary

SKU: PROTQ9Y3A5
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Shwachman Bodian Diamond syndrome (SBDS) (NM_016038) Human Recombinant Protein

View all Shwachman Bodian-Diamond syndrome recombinant proteins

SKU/Catalog Number

PROTQ9Y3A5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human Shwachman-Bodian-Diamond syndrome (SBDS)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Shwachman Bodian Diamond syndrome (SBDS) (NM_016038) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y3A5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

28.6 kDa

Amino Acid Sequence

MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE

Validation Images & Assay Conditions

Gene/Protein Information For SBDS (Source: Uniprot.org, NCBI)

Gene Name

SBDS

Full Name

Ribosome maturation protein SBDS

Weight

28.6 kDa

Superfamily

SDO1/SBDS family

Alternative Names

FLJ10917; ribosome maturation protein SBDS; SDSCGI-97; Shwachman-Bodian-Diamond syndrome protein; Shwachman-Bodian-Diamond syndrome; SWDS SBDS CGI-97, SDO1, SDS, SWDS SBDS ribosome maturation factor ribosome maturation protein SBDS|SBDS, ribosome assembly guanine nucleotide exchange factor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SBDS, check out the SBDS Infographic

SBDS infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SBDS: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y3A5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Shwachman Bodian Diamond syndrome (SBDS) (NM_016038) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Shwachman Bodian Diamond syndrome (SBDS) (NM_016038) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Shwachman Bodian Diamond syndrome (SBDS) (NM_016038) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y3A5
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.