SHF (NM_138356) Human Recombinant Protein

SHF protein,

Recombinant protein of human Src homology 2 domain containing F (SHF)

Product Info Summary

SKU: PROTQ7M4L6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SHF (NM_138356) Human Recombinant Protein

View all SHF recombinant proteins

SKU/Catalog Number

PROTQ7M4L6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human Src homology 2 domain containing F (SHF)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SHF (NM_138356) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ7M4L6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

46.6 kDa

Amino Acid Sequence

MQQEGGPVRSAPCRTGTLEGSRQGSPGHRKRASPKGSLSSAQPHSWMLTPSPLNSHCAHREPISSSPQPVANGPKQKKKSNWRSTTRLRIIRLRDRLEPRPLAILEDYADPFDVQETGEGSAGASGAPEKVPENDGYMEPYEAQKMMAEIRGSKETATQPLPLYDTPYEPEEDGATPEGEGAPWPRESRLPEDDERPPEEYDQPWEWKKERISKAFAVDIKVIKDLPWPPPVGQLDSSPSLPDGDRDISGPASPLPEPSLEDSSAQFEGPEKSCLSPGREEKGRLPPRLSAGNPKSAKPLSMEPSSPLGEWTDPALPLENQVWYHGAISRTDAENLLRLCKEASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVAIRTL

Validation Images & Assay Conditions

Gene/Protein Information For SHF (Source: Uniprot.org, NCBI)

Gene Name

SHF

Full Name

SH2 domain-containing adapter protein F

Weight

46.6 kDa

Alternative Names

Src homology 2 domain containing F SHF Src homology 2 domain containing F SH2 domain-containing adapter protein F|CTD-2651B20.7

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SHF, check out the SHF Infographic

SHF infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SHF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ7M4L6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SHF (NM_138356) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SHF (NM_138356) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SHF (NM_138356) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ7M4L6
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.