SH3GL3 (NM_003027) Human Recombinant Protein

SH3GL3 protein,

Product Info Summary

SKU: PROTQ99963
Size: 20 µg
Source: HEK293T

Product Name

SH3GL3 (NM_003027) Human Recombinant Protein

View all SH3GL3 recombinant proteins

SKU/Catalog Number

PROTQ99963

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human SH3-domain GRB2-like 3 (SH3GL3), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SH3GL3 (NM_003027) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99963)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

39.1 kDa

Amino Acid Sequence

MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTGSNIPMDQPCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ

Validation Images & Assay Conditions

Gene/Protein Information For SH3GL3 (Source: Uniprot.org, NCBI)

Gene Name

SH3GL3

Full Name

Endophilin-A3

Weight

39.1 kDa

Superfamily

endophilin family

Alternative Names

CNSA3; EEN-B2; endophilin-A3; SH3D2C; SH3-domain GRB2-like 3 SH3GL3 CNSA3, EEN-B2, HsT19371, SH3D2C, SH3P13 SH3 domain containing GRB2 like 3, endophilin A3 endophilin-A3|SH3 domain containing GRB2 like endophilin A3|SH3 domain protein 2C|SH3 domain-containing GRB2-like protein 3|SH3-domain GRB2-like 3|endophilin-3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SH3GL3, check out the SH3GL3 Infographic

SH3GL3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SH3GL3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ99963

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SH3GL3 (NM_003027) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SH3GL3 (NM_003027) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SH3GL3 (NM_003027) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ99963
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.