SEPTIN7 (NM_001788) Human Recombinant Protein

SEPTIN7 protein,

Recombinant protein of human septin 7 (SEPT7), transcript variant 1

Product Info Summary

SKU: PROTQ16181
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SEPTIN7 (NM_001788) Human Recombinant Protein

View all SEPTIN7 recombinant proteins

SKU/Catalog Number

PROTQ16181

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human septin 7 (SEPT7), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SEPTIN7 (NM_001788) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ16181)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

50.5 kDa

Amino Acid Sequence

MAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIF

Validation Images & Assay Conditions

Gene/Protein Information For SEPTIN7 (Source: Uniprot.org, NCBI)

Gene Name

SEPTIN7

Full Name

Septin-7

Weight

50.5 kDa

Superfamily

TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily

Alternative Names

Septin-7 SEPTIN7 CDC10, CDC3, NBLA02942, SEPT7, SEPT7A septin 7 septin-7|CDC10 (cell division cycle 10, S. cerevisiae, homolog)|CDC10 protein homolog|septin 7 variant 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SEPTIN7, check out the SEPTIN7 Infographic

SEPTIN7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SEPTIN7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ16181

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SEPTIN7 (NM_001788) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SEPTIN7 (NM_001788) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SEPTIN7 (NM_001788) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ16181
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.