Secretory lectin ZG16 (ZG16) (NM_152338) Human Recombinant Protein

Zg16 protein,

Product Info Summary

SKU: PROTO60844
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Secretory lectin ZG16 (ZG16) (NM_152338) Human Recombinant Protein

View all Zg16 recombinant proteins

SKU/Catalog Number

PROTO60844

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human zymogen granule protein 16 homolog (rat) (ZG16)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Secretory lectin ZG16 (ZG16) (NM_152338) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO60844)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18 kDa

Amino Acid Sequence

MLTVALLALLCASASGNAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRC

Validation Images & Assay Conditions

Gene/Protein Information For ZG16 (Source: Uniprot.org, NCBI)

Gene Name

ZG16

Full Name

Zymogen granule membrane protein 16

Weight

18 kDa

Superfamily

jacalin lectin family

Alternative Names

hZG16; JCLN; JCLN1; MGC34820; ZG16A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ZG16, check out the ZG16 Infographic

ZG16 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ZG16: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO60844

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Secretory lectin ZG16 (ZG16) (NM_152338) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Secretory lectin ZG16 (ZG16) (NM_152338) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Secretory lectin ZG16 (ZG16) (NM_152338) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO60844
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.