SEC22L2 (SEC22A) (NM_012430) Human Recombinant Protein

SEC22L2 protein,

Recombinant protein of human SEC22 vesicle trafficking protein homolog A (S. cerevisiae) (SEC22A)

Product Info Summary

SKU: PROTQ96IW7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SEC22L2 (SEC22A) (NM_012430) Human Recombinant Protein

View all SEC22L2 recombinant proteins

SKU/Catalog Number

PROTQ96IW7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human SEC22 vesicle trafficking protein homolog A (S. cerevisiae) (SEC22A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SEC22L2 (SEC22A) (NM_012430) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96IW7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

34.8 kDa

Amino Acid Sequence

MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQLPDRCTLKTGHYNINFISSLGVSYMMLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQRTKQRYNNPRSLSTKINLSDMQTEIKLRPPYQISMCELGSANGVTSAFSVDCKGAGKISSAHQRLEPATLSGIVGFILSLLCGALNLIRGFHAIESLLQSDGDDFNYIIAFFLGTAACLYQCYLLVYYTGWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQGKAPDYDV

Validation Images & Assay Conditions

Gene/Protein Information For SEC22A (Source: Uniprot.org, NCBI)

Gene Name

SEC22A

Full Name

Vesicle-trafficking protein SEC22a

Weight

34.8 kDa

Superfamily

synaptobrevin family

Alternative Names

sec22 homolog; SEC22 vesicle trafficking protein homolog A (S. cerevisiae); SEC22 vesicle trafficking protein-like 2 (S. cerevisiae); SEC22 vesicle trafficking protein-like 2; SEC22 vesicle-trafficking protein-like 2; SEC22L2SEC22 vesicle-trafficking protein homolog A; vesicle-trafficking protein SEC22a SEC22A SEC22L2 SEC22 homolog A, vesicle trafficking protein vesicle-trafficking protein SEC22a|SEC22 vesicle trafficking protein homolog A|SEC22 vesicle trafficking protein-like 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SEC22A, check out the SEC22A Infographic

SEC22A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SEC22A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96IW7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SEC22L2 (SEC22A) (NM_012430) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SEC22L2 (SEC22A) (NM_012430) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SEC22L2 (SEC22A) (NM_012430) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96IW7
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.