SAPK4 (MAPK13) (NM_002754) Human Recombinant Protein

p38 delta/SAPK4 protein,

Product Info Summary

SKU: PROTO15264
Size: 20 µg
Source: HEK293T

Product Name

SAPK4 (MAPK13) (NM_002754) Human Recombinant Protein

View all p38 delta/SAPK4 recombinant proteins

SKU/Catalog Number

PROTO15264

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mitogen-activated protein kinase 13 (MAPK13)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SAPK4 (MAPK13) (NM_002754) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO15264)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

41.9 kDa

Amino Acid Sequence

MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL

Validation Images & Assay Conditions

Gene/Protein Information For MAPK13 (Source: Uniprot.org, NCBI)

Gene Name

MAPK13

Full Name

Mitogen-activated protein kinase 13

Weight

41.9 kDa

Superfamily

protein kinase superfamily

Alternative Names

EC 2.7.11; EC 2.7.11.24; MAP kinase 13; MAPK 13; MAPK13; MGC99536; mitogen-activated protein kinase 13; Mitogen-activated protein kinase p38 delta; p38 delta; p38delta; PRKM13; SAPK4MAP kinase p38 delta; Stress-activated protein kinase 4 MAPK13 MAPK 13, MAPK-13, PRKM13, SAPK4, p38delta mitogen-activated protein kinase 13 mitogen-activated protein kinase 13|MAP kinase 13|MAP kinase p38 delta|mitogen-activated protein kinase p38 delta|stress-activated protein kinase 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MAPK13, check out the MAPK13 Infographic

MAPK13 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MAPK13: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO15264

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SAPK4 (MAPK13) (NM_002754) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SAPK4 (MAPK13) (NM_002754) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SAPK4 (MAPK13) (NM_002754) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO15264
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.