SAE1 (NM_001145713) Human Recombinant Protein

SUMO Activating Enzyme E1 (SAE1) protein,

Product Info Summary

SKU: PROTQ9UBE0
Size: 20 µg
Source: HEK293T

Product Name

SAE1 (NM_001145713) Human Recombinant Protein

View all SUMO Activating Enzyme E1 (SAE1) recombinant proteins

SKU/Catalog Number

PROTQ9UBE0

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SAE1 (NM_001145713) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UBE0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

32.9 kDa

Amino Acid Sequence

MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQGPVSAGPSSQQLLLLRWHEGEWDCGVPWPQVNSRFGSPRDANCSMPTCIPCPLPS

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For SAE1 (Source: Uniprot.org, NCBI)

Gene Name

SAE1

Full Name

SUMO-activating enzyme subunit 1

Weight

32.9 kDa

Superfamily

ubiquitin-activating E1 family

Alternative Names

AOS1; AOS1activator of SUMO1; FLJ3091; HSPC140; SAE1; SUA1; SUA1sentrin/SUMO-activating protein AOS1; SUMO Activating Enzyme E1 (SAE1/UBA2); SUMO-1 activating enzyme E1 N subunit; SUMO1 activating enzyme subunit 1; SUMO-1 activating enzyme subunit 1; SUMO-activating enzyme subunit 1; UBA2; Ubiquitin-like 1-activating enzyme E1A; ubiquitin-like protein SUMO-1 activating enzyme; UBLE1A SAE1 AOS1, HSPC140, SUA1, UBLE1A SUMO1 activating enzyme subunit 1 SUMO-activating enzyme subunit 1|SUMO-1 activating enzyme E1 N subunit|SUMO-1 activating enzyme subunit 1|activator of SUMO1|sentrin/SUMO-activating protein AOS1|ubiquitin-like 1-activating enzyme E1A|ubiquitin-like protein SUMO-1 activating enzyme

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SAE1, check out the SAE1 Infographic

SAE1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SAE1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UBE0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SAE1 (NM_001145713) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SAE1 (NM_001145713) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SAE1 (NM_001145713) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UBE0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.