S100A4 (NM_019554) Human Recombinant Protein

S100A4 protein,

Product Info Summary

SKU: PROTP26447
Size: 20 µg
Source: HEK293T

Product Name

S100A4 (NM_019554) Human Recombinant Protein

View all S100A4 recombinant proteins

SKU/Catalog Number

PROTP26447

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human S100 calcium binding protein A4 (S100A4), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

S100A4 (NM_019554) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP26447)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.5 kDa

Amino Acid Sequence

MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Validation Images & Assay Conditions

Gene/Protein Information For S100A4 (Source: Uniprot.org, NCBI)

Gene Name

S100A4

Full Name

Protein S100-A4

Weight

11.5 kDa

Superfamily

S-100 family

Alternative Names

18A2; 42A; Calvasculin; CAPL; CAPLS100 calcium binding protein A4 (calcium protein, calvasculin, metastasin; fibroblast-specific protein-1,42A; FSP1; leukemia multidrug resistance associated protein; malignant transformation suppression 1; Metastasin; MTS1; murine placental homolog); P9KA; PEL98; Placental calcium-binding protein; Protein Mts1; protein S100-A4; S100 calcium binding protein A4; S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog); S100 calcium-binding protein A4; S100A4 S100A4 18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98 S100 calcium binding protein A4 protein S100-A4|S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)|calcium placental protein|fibroblast-specific protein-1|leukemia multidrug resistance associated protein|malignant transformation suppression 1|metastasin 1|murine placental homolog|placental calcium-binding protein|protein Mts1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on S100A4, check out the S100A4 Infographic

S100A4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for S100A4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used S100A4 (NM_019554) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For S100A4 (NM_019554) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for S100A4 (NM_019554) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP26447
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.