S100 calcium binding protein A14 (S100A14) (NM_020672) Human Recombinant Protein

S100 calcium binding protein A14 protein,

Product Info Summary

SKU: PROTQ9HCY8
Size: 20 µg
Source: HEK293T

Product Name

S100 calcium binding protein A14 (S100A14) (NM_020672) Human Recombinant Protein

View all S100 calcium binding protein A14 recombinant proteins

SKU/Catalog Number

PROTQ9HCY8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human S100 calcium binding protein A14 (S100A14)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

S100 calcium binding protein A14 (S100A14) (NM_020672) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9HCY8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.5 kDa

Amino Acid Sequence

MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Validation Images & Assay Conditions

Gene/Protein Information For S100A14 (Source: Uniprot.org, NCBI)

Gene Name

S100A14

Full Name

Protein S100-A14

Weight

11.5 kDa

Superfamily

S-100 family

Alternative Names

protein S100-A14; S100 calcium binding protein A14; S100 calcium-binding protein A14; S100A15BCMP84breast cancer membrane protein 84; S114 S100A14 BCMP84, S100A15 S100 calcium binding protein A14 protein S100-A14|S114|breast cancer membrane protein 84

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on S100A14, check out the S100A14 Infographic

S100A14 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for S100A14: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9HCY8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used S100 calcium binding protein A14 (S100A14) (NM_020672) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For S100 calcium binding protein A14 (S100A14) (NM_020672) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for S100 calcium binding protein A14 (S100A14) (NM_020672) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9HCY8
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.