RUSC1 (NM_014328) Human Recombinant Protein

RUSC1 protein,

Recombinant protein of human RUN and SH3 domain containing 1 (RUSC1), transcript variant 4

Product Info Summary

SKU: PROTQ9BVN2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RUSC1 (NM_014328) Human Recombinant Protein

View all RUSC1 recombinant proteins

SKU/Catalog Number

PROTQ9BVN2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human RUN and SH3 domain containing 1 (RUSC1), transcript variant 4

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RUSC1 (NM_014328) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BVN2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

46.4 kDa

Amino Acid Sequence

MAEAQSGTGQLQEQKKGLLIAVSVSVDKIISHFGAARNLVQKAQLGDSRLSPDVGHLVLTTLCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVKPGSSTRSLGTLYSQVSRLAPLSSSRSRFHAFILGLLNTKQLELWFSSLQEDAGLLSLLYLPTGFFSLARGGCPSLSTELLLLLQPLSVLTFHLDLLFEHHHHLPLGPPQAPAPPGPPPALQQTMQAMLHFGGRLAQSLRGTSKEAASDPSDSPNLPTPGSWWEQLTQASRVYASGGTEGFPLSRWAPGRHGTAAEEGAQERPLPTDEMAPGRGLWLGRLFGVPGGPAENENGALKSRRPSSWLPPTVSVLALVKRGAPPEMPSPQELEASAPRMVQTHRAVRALCDHTAARPDQLSFRRGEVLRVITTVDEDWLRCGRDGMEGLVPVGYTSLVL

Validation Images & Assay Conditions

Gene/Protein Information For RUSC1 (Source: Uniprot.org, NCBI)

Gene Name

RUSC1

Full Name

RUN and SH3 domain-containing protein 1

Weight

46.4 kDa

Alternative Names

DKFZp761A1822; Nesca; NESCARUN and SH3 domain-containing protein 1; New molecule containing SH3 at the carboxy-terminus; RUN and SH3 domain containing 1 RUSC1 NESCA RUN and SH3 domain containing 1 RUN and SH3 domain-containing protein 1|new molecule containing SH3 at the carboxy-terminus

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RUSC1, check out the RUSC1 Infographic

RUSC1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RUSC1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BVN2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RUSC1 (NM_014328) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RUSC1 (NM_014328) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RUSC1 (NM_014328) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BVN2
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.