RPS20 (NM_001146227) Human Recombinant Protein

RPS20 protein,

Product Info Summary

SKU: PROTP60866
Size: 20 µg
Source: HEK293T

Product Name

RPS20 (NM_001146227) Human Recombinant Protein

View all RPS20 recombinant proteins

SKU/Catalog Number

PROTP60866

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ribosomal protein S20 (RPS20), transcript variant 1.

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RPS20 (NM_001146227) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP60866)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15.8 kDa

Amino Acid Sequence

MAFKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVELIESTDAEPMDTEGQQYTLRSVFESPGTCPF

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For RPS20 (Source: Uniprot.org, NCBI)

Gene Name

RPS20

Full Name

40S ribosomal protein S20

Weight

15.8 kDa

Superfamily

universal ribosomal protein uS10 family

Alternative Names

40S ribosomal protein S20; FLJ27451; MGC102930; ribosomal protein S20 RPS20 S20, uS10 ribosomal protein S20 40S ribosomal protein S20|small ribosomal subunit protein uS10

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RPS20, check out the RPS20 Infographic

RPS20 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RPS20: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP60866

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RPS20 (NM_001146227) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RPS20 (NM_001146227) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RPS20 (NM_001146227) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP60866
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.